A practical reference on deamidation: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-08-01. Anything still debated is marked as such rather than presented as settled.
The peptide lacks cysteine, methionine, and tryptophan, so disulfide scrambling and sulfur oxidation are not major degradation routes. Instead, aspartate residues can undergo isomerization or cyclization to succinimide intermediates, generating isoaspartate variants. Hydrolysis of peptide bonds also occurs slowly in solution. These changes may reduce biological activity even when the main peak remains detectable. Stability studies therefore track both potency and the appearance of related substances.
Lyophilized thymosin alpha 1 is typically stored refrigerated at 2 to 8 degrees Celsius and kept away from light. Reconstituted solutions are less stable and are usually used promptly after preparation. Repeated freeze-thaw cycles are avoided because they can promote aggregation and loss of activity. The peptide adsorbs to some plastic and glass surfaces, so a carrier protein is often added to dilute working solutions. Manufacturer instructions and published protocols both govern handling.
Identity and purity testing for thymosin alpha 1 relies mainly on reversed-phase high-performance liquid chromatography and mass spectrometry. Chromatography separates the parent peptide from truncated or modified variants, while mass spectrometry confirms the expected molecular mass. Amino acid analysis and peptide mapping provide additional sequence confirmation. Counterion content, water content, and residual solvents are measured separately as part of specification testing. No single method captures every attribute, so laboratories combine several techniques.
Quality control for thymosin alpha-1 focuses on identity, purity, and potency. Identity is confirmed by mass spectrometry and amino acid analysis, while purity is assessed by chromatography with limits on related substances and residual solvents. Potency assays may use cell-based immune readouts, but these are not standardized across laboratories. Regulatory status differs by jurisdiction; no product is approved in the United States for clinical use, whereas some other countries register injectable forms for specific indications.
Quantifying thymosin alpha-1 in a sample usually relies on reverse-phase high-performance liquid chromatography. The peptide lacks strong chromophores, so detection often occurs at 214 nm, where the peptide backbone absorbs. Mass spectrometry provides confirmatory identification and can detect sequence variants or truncations. Immunoassays have been used in biological matrices, but they may cross-react with related fragments. For purity assessment, chromatographic peak area gives the main component percentage, while mass accuracy verifies molecular identity.
| Property | Value | Notes |
|---|---|---|
| Physical form | Lyophilized powder | Reconstituted before use |
| Typical storage | 2-8 °C, protected from light | Applies to the powder |
| Reconstitution solvent | Sterile water or saline | Follow product labeling |
| Solution stability | Shorter than the powder | Refrigerate and use promptly |
| Primary purity method | Reversed-phase HPLC | Detects related substances |
Several factors accelerate degradation: alkaline pH, elevated temperature, exposure to oxidants, and the presence of residual moisture. Deamidation of asparagine residues and oxidation of methionine are the most commonly reported degradation routes. Because the peptide lacks disulfide bonds, it does not undergo the thiol-related aggregation seen in some other biologics, but physical aggregation can still occur at high concentration. Stability data are product-specific, and extrapolating shelf life between formulations is not reliable.
Lyophilized thymosin alpha-1 is generally stored at or below minus twenty degrees Celsius, protected from moisture and light. Short-term handling at ambient temperature is possible for dry powder, but reconstituted solutions degrade faster and are usually kept at two to eight degrees Celsius with a defined expiry of days rather than weeks. Repeated freeze-thaw cycles should be avoided because they promote aggregation and loss of potency. Exact limits depend on the formulation and should follow the supplier's documentation.
Identity and purity are normally assessed by reversed-phase high-performance liquid chromatography, which separates the peptide from related impurities and truncation products. Mass spectrometry confirms molecular mass and detects modifications such as deamidation or oxidation. Amino acid analysis and peptide mapping provide additional sequence-level confirmation. For research material, a certificate of analysis typically reports these results together with water content and counter-ion identity, since the lyophilized powder is often supplied as an acetate or trifluoroacetate salt.
Identity and purity are normally confirmed by reversed-phase high-performance liquid chromatography and mass spectrometry. The expected mass for the acetylated 28-residue peptide is close to 3108 daltons, and a mass shift indicates a modification or truncation. Peptide mapping after enzymatic digestion can resolve sequence-level questions. Counter-ion content, water content, and residual solvents are separate quality attributes that a certificate of analysis may or may not report. Aggregation is monitored by size-exclusion chromatography when relevant.
Thymosin alpha-1 is supplied as a lyophilized powder in most research settings. The solid dissolves readily in water and in common aqueous buffers, and it is typically reconstituted shortly before use. Solutions are clear and colourless at ordinary working concentrations. Because the peptide is hygroscopic, weighing and reconstitution are usually performed with minimal exposure to ambient air. Aliquots are prepared to avoid repeated freeze-thaw cycles, and working solutions are kept cold.
Long-term storage is generally at minus twenty degrees Celsius or colder, preferably desiccated and protected from light. Lyophilized material is more stable than reconstituted solution, which degrades faster at room temperature. Stability depends on pH, ionic strength, and the presence of oxidising agents. Published stability data for the peptide are limited, so storage claims in catalogues should be treated as general guidance rather than measured guarantees. Freeze-thaw cycles are kept to a minimum.
Acupuncture is a substantial part of traditional Chinese medicine (TCM). Early acupuncture beliefs relied on concepts that are common in TCM, such as a life force energy called qi. Qi was believed to flow from the body's primary organs (zang-fu organs) to the "superficial" body tissues of the skin, muscles, tendons, bones, and joints, through channels called meridians. Acupuncture points where needles are inserted are mainly (but not always) found at locations along the meridians. Acupuncture points not found along a meridian are called extraordinary points and those with no designated site are called A-shi points. In TCM, disease is generally perceived as a disharmony or imbalance in energies such as yin, yang, qi, xuĕ, zàng-fǔ, meridians, and of the interaction between the body and the environment. Therapy is based on which "pattern of disharmony" can be identified. For example, some diseases are believed to be caused by meridians being invaded with an excess of wind, cold, and damp. In order to determine which pattern is at hand, practitioners examine things like the color and shape of the tongue, the relative strength of pulse-points, the smell of the breath, the quality of breathing, or the sound of the voice. TCM and its concept of disease does not strongly differentiate between the cause and effect of symptoms. Acupuncture was and is practiced differently by various Chinese philosophical schools, and differs from acupuncture from Korea and Japan.
Caryophyllene (), more formally (−)-β-caryophyllene (BCP), is a natural bicyclic sesquiterpene that occurs widely in nature. Caryophyllene is notable for having a cyclobutane ring, as well as a trans-double bond in a 9-membered ring, both rarities in nature.
A coup d'état ( ; French: [ku deta] ; lit. 'stroke of state'), or simply a coup, is typically an illegal and overt attempt by a military organization or other government elites to unseat an incumbent person or leadership. A self-coup is said to take place when a leader, having come to power through legal means, tries to stay in power through illegal means. By one estimate, there were 457 coup attempts from 1950 to 2010, half of which were successful. Most coup attempts occurred in the mid-1960s, but there were also large numbers of coup attempts in the mid-1970s and the early 1990s. Coups occurring in the post-Cold War period have been more likely to result in democratic systems than Cold War coups, though coups still mostly perpetuate authoritarianism. Many factors may lead to the occurrence of a coup, as well as determine the success or failure of a coup. Once a coup is underway, coup success is driven by coup-makers' ability to get others to believe that the coup attempt will be successful. The number of successful coups has decreased over time. Failed coups in authoritarian systems are likely to strengthen the power of the authoritarian ruler. The cumulative number of coups is a strong predictor of future coups, a phenomenon referred to as the "coup trap". In what is referred to as "coup-proofing", regimes create structures that make it hard for any small group to seize power. These coup-proofing strategies may include the strategic placing of family, ethnic, and religious groups in the military and the fragmenting of military and security agencies.
== Further reading == Daei Sorkhabi A, ZareDini M, Fazlollahi A, Sarkesh A, Naseri A, Mousavi SE, et al. (December 2023). "The safety and efficacy of tislelizumab, alone or in combination with chemotherapy, for the treatment of non-small cell lung cancer: a systematic review of clinical trials". BMC Pulmonary Medicine. 23 (1): 495. doi:10.1186/s12890-023-02755-3. PMC 10704633. PMID 38066549. Liu S, Dou L, Li S (2024). "Immune checkpoint inhibitors versus chemotherapy as second-line therapy for advanced oesophageal squamous cell carcinoma: a systematic review and economic evaluation". Therapeutic Advances in Gastroenterology. 17 17562848241233134. doi:10.1177/17562848241233134. PMC 10903196. PMID 38425370. Ntellas P, Chau I (January 2024). "Updates on Systemic Therapy for Hepatocellular Carcinoma". American Society of Clinical Oncology Educational Book. American Society of Clinical Oncology. Annual Meeting. 44 e430028. doi:10.1200/EDBK_430028. PMID 38175973.
=== Orthologs === Orthologs of SLC39A13 are found across vertebrates and other animal lineages, suggesting that ZIP13 is evolutionarily conserved. Conservation of the ZIP domain and transmembrane regions suggests that these protein regions are important for zinc transport function.
Sources: en.wikipedia.org
Ansuvimab was developed by the Vaccine Research Center with support of the United States National Institutes of Health and the Defense Advanced Projects Agency. The heavy and light chain sequences of ansuvimab mAb were cloned into CHO cell lines to enable large-scale production of antibody product for use in humans. In early 2018, a Phase 1 clinical trial of ansuvimab's safety, tolerability and pharmacokinetics was conducted by Dr. Martin Gaudinski within the Vaccine Research Center Clinical Trials Program that is led by Dr. Julie E. Ledgerwood. The study was performed in the United States at the NIH Clinical Center and tested single dose infusions of ansuvimab infused over 30 minutes. The study showed that ansuvimab was safe, had minimal side effects and had a half-life of 24 days. A license for ansuvimab was obtained by Ridgeback Biotherapeutics in 2018, from the National Institutes of Health-National Institute of Allergy and Infectious Diseases. Ansuvimab was given orphan drug status in May 2019 and March 2020.
By 1951, Alec Todd and collaborators at the University of Cambridge had determined by biochemical methods how the backbone of DNA is structured via the successive linking of carbon atoms 3 and 5 of the sugar to phosphates. This would help to corroborate Watson and Crick's later X-ray structural work. Todd would later be awarded the 1957 Nobel Prize in Chemistry for this and other discoveries related to DNA. Late in 1951, Francis Crick started working with James Watson at the Cavendish Laboratory within the University of Cambridge. DNA's role in heredity was confirmed in 1952 when Alfred Hershey and Martha Chase in the Hershey–Chase experiment showed that DNA is the genetic material of the enterobacteria phage T2.
genetic abnormalities in the metabolism of ethanol, which can cause the ethanol metabolite, acetaldehyde, to accumulate in tissues and trigger the release of histamine, or true allergy reactions to allergens occurring naturally in, or contaminating, alcoholic beverages (particularly wine and beer), and other unknown causes.
== For vitamins == A number of vitamins have distinct vitamers of distinct biological potencies. There is a system in place also called the international unit to describe the relative strength of these different molecular forms. Like the biological international unit, the IU for vitamins is also an arbitrary number that cannot be interconverted among different types of activities. By 1934, the WHO (then the League of Nations Health Organisation) had already defined the international units for vitamins A, B1, C, and D. Unlike biologic preparations, small molecules like vitamins can be very easily purified to yield products that are equivalent in potency. As a result, a simple mass conversion (as opposed to an assay) suffices to obtain the IU:
Furthermore, it is possible to transplant freeze-dried donor tissue. The freeze-drying process ensures this tissue is dead, so there is no chance of rejection. Research from two trials in Iran provide low to moderate evidence that graft rejection is more likely to occur in penetrating keratoplasty than in DALK, though the likelihood for graft failure were similar with both procedures.
Sources: en.wikipedia.org
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Petroleum is a fossil fuel derived from fossilized organic materials, such as zooplankton and algae. Vast amounts of these remains settled to sea or lake bottoms where they were covered in stagnant water (water with no dissolved oxygen) or sediments (such as mud and silt) faster than they could decompose aerobically. Approximately 1 m below this sediment, water oxygen concentration was low, below 0.1 mg/L, and anoxic conditions existed. Temperatures also remained constant. As further layers settled into the sea or lake bed, intense heat and pressure built up in the lower regions. This process caused the organic matter to change, first into a waxy material known as kerogen (found in various oil shales around the world) and then with more heat into liquid and gaseous hydrocarbons via a process known as catagenesis. Formation of petroleum occurs from hydrocarbon pyrolysis in a variety of mainly endothermic reactions at high temperatures or pressures, or both. These phases are described in detail below.
=== Whistleblowing hotline === In business, whistleblowing hotlines are usually deployed to mitigate risk, with the intention of providing secure, anonymous reporting for employees or third-party suppliers who may otherwise be fearful of reprisals from their employer. As such, implementing a corporate whistleblowing hotline is often seen as a step toward compliance and can also highlight an organization's stance on ethics. It is widely agreed that implementing a dedicated service for whistleblowers has a positive effect on organizational culture. A whistleblowing hotline is sometimes also referred to as an ethics hotline or "Speak Up" hotline and is often facilitated by an outsourced service provider to encourage potential disclosers to come forward. In 2018, the Harvard Business Review published findings to support the idea that whistleblowing hotlines are crucial to keeping companies healthy, stating, "More whistles blown are a sign of health, not illness."
While von Grosse's claim that Fermi was actually producing protactinium (element 91) was quickly tested and disproved, Noddack's proposal that the uranium had been shattered into two or more much smaller fragments was simply ignored by most because existing nuclear theory did not include a way for this to be possible. Fermi and his team maintained that they were in fact synthesizing a new element, but the issue remained unresolved for several years. Although the many different and unknown radioactive half-lives in the experiment's results showed that several nuclear reactions were occurring, Fermi's group could not prove that element 93 was being produced unless they could isolate it chemically. They and many other scientists attempted to accomplish this, including Otto Hahn and Lise Meitner who were among the best radiochemists in the world at the time and supporters of Fermi's claim, but they all failed. Much later, it was determined that the main reason for this failure was because the predictions of element 93's chemical properties were based on a periodic table which lacked the actinide series. This arrangement placed protactinium below tantalum, uranium below tungsten, and further suggested that element 93, at that point referred to as eka-rhenium, should be similar to the group 7 elements, including manganese and rhenium.
== Formulations == Insulin aspart can be used in an insulin pump and insulin pen for subcutaneous injection. Additionally, it can be used with an injection port such as the I-port. Insulin aspart has a more rapid onset, and a shorter duration of activity than normal human insulin. Insulin aspart can also be used with external insulin pumps.
Sources: en.wikipedia.org
The lyophilized powder is kept refrigerated at 2 to 8 degrees Celsius and protected from light. Reconstituted solutions should be used promptly. Freezing and thawing repeatedly is avoided.
Reversed-phase HPLC is the primary tool for purity, paired with mass spectrometry for identity. Amino acid analysis and peptide mapping add sequence confirmation. Several techniques are combined because no single test covers every attribute.
It lacks sulfur-containing residues, so oxidation is limited. Aspartate isomerization and slow hydrolysis are the main concerns. Solution stability is shorter than that of the lyophilized powder.
Reverse-phase HPLC with ultraviolet detection at 214 nm is common. Mass spectrometry is used to confirm molecular identity and detect modifications. Immunoassays exist but may not distinguish the intact peptide from fragments.